"Эволюция" системы свертывания крови позвоночных.
Бихи vs. Дулиттл+Миллер+Перах.
Константин Виолован.

Эта история имеет свое громкое начало с публикации книги профессора биохимии Майкла Бихи "Черный ящик Дарвина. Биохимический вызов эволюции", вышедшей в 1996 г. Основной тезис книги - большинство биохимических систем чрезвычайно сложны и их сложность неуменьшаема, то есть удаление одного из компонентов системы нарушает ее функцию. Бихи делает следующий вывод из этого наблюдения: постепенное образование таких систем невозможно, а эволюция из других систем, с постепенным изменением функции, крайне маловероятна. (Подробнее о сложных системах, их неупрощаемости и эволюции см. в моей критической заметке по статье Марка Пераха "Разумный замысел или слепая случайность",

В качестве одного из примеров сложных неупрощаемых систем Бихи приводит систему, отвечающую за свертывание крови и последующее растворение тромба (в дальнейшем "система свертывания крови", ССК). Сам пример не очень наглядный: ССК нечетко определена, неизвестно, сколько компонентов входит в ее состав - 26, меньше или в несколько раз больше, многие компоненты выполняют функции в других системах организма. Думаю, не согрешу против истины, сказав, что 90% врачей и биологов не смогут нарисовать схему взаимодействия хотя бы 13 основных факторов свертывания. Почему же Бихи выбрал, среди прочих, именно эту систему? Дело в том, что ССК - одна из немногих, а, может быть, и единственная на тот момент сложная биохимическая система, для которой была предложена "история" эволюции. Сделал это в 1993 году профессор биохимии Рассел Дулиттл.

Дулиттл - ведущий исследователь сравнительной биохимии ССК, отдавший любимой теме 40 лет научных изысканий. Свой обзор эволюции ССК Дулиттл поместил в центральном отраслевом научном журнале "Thrombosis and Haemostasis", и назвал его "Эволюция свертывания крови позвоночных. Случай инь и ян". Дулиттл пишет: "свертывание крови - тонко сбалансированный феномен, включающий в себя протеазы (белки, расщепляющие другие белки -К.В.), антипротеазы и субстраты протеаз. В общем, каждое действие, направленное вперед, порождает обратный ответ. Разные метафоры могут быть использованы для описания его пошаговой эволюции: действие - противодействие, хорошие новости и плохие новости. Однако я предпочитаю, инь и ян. В древней китайской космологии все, что сущее является результатом комбинирования противоположных начал, инь и ян. Ян - это мужское начало, олицетворяющее активность, высоту, тепло, свет, и сухость. Инь, женский противовес, персонифицирует пассивность, глубину, холод, темноту и влагу. Их союз порождает настоящую суть всех вещей. Имея в виду, что это только метафора, рассмотрим сценарий с инь и ян в отношении эволюции свертывания у позвоночных. Я произвольно обозначил ферменты и их предшественники как ян, а неферменты - как инь."

Далее следует перечисление 17 этапов образования "инь", "ян", их "союзов" и "разводов". Я не буду приводить их всех, с ключевыми этапами мы познакомимся ниже, а вот реакцию Бихи процитирую: "первое, на что необходимо обратить внимание, это на отсутствие причинных факторов в сценарии. Так, тканевой фактор "появляется", фибриноген "рождается", антиплазмин "возникает"..., фактор 13 "высвобождается" и т.д... Очевидно, Дулиттл имеет в виду последовательный дарвиновский сценарий с ненаправленной случайной дупликацией и тасование участков генов (доменов - К.В.). Но представьте себе невероятную удачу, которая требуется для того, чтобы нужные домены стали в нужных местах... Образование нового белка ССК путем тасования подобно случайной выборке дюжины предложений из энциклопедии в надежде на то, что в результате получится связный параграф..."

Здесь необходимо отметить, что большинство белков имеют модульную, доменную структуру, они состоят из более коротких участков, длиной в несколько десятков-сотен аминокислотных остатков, выполняющих отдельные подфункции (прикрепление к мембране, распознаванию отдельных(-ными) молекул(-ами), ферментативная функция и т.д.). В настоящее время известно несколько сотен доменов с более-менее понятной функцией, что дает возможность эволюционистам постулировать образование новых белков не через комбинаторно-невероятный перебор сотен аминокислот, а путем тасования небольшого числа доменов, с последующей оптимизацией путем точечных мутаций и естественного отбора.

Однако, даже если закрыть глаза на низкую вероятность получения нужной "заготовки" путем тасования пары тысяч доменов, возникают дополнительные проблемы:

  1. не всякий белок, имеющий нужное расположение доменов, будет выполнять необходимую функцию - необходима тонкая настройка в доменах. Иными словами, болванка для ключа имеет те же "домены", что и ключ от моей квартиры - "держало" и "втыкало", но это не значит, что я смогу открыть этой болванкой свой замок;
  2. пошаговая эволюция ССК почти на каждом шагу сталкивается с проблемой отсутствия естественных мишеней для новообразованных белков. То есть, может быть у меня и есть ключ, но еще нет замка, к которому он подходит. Это препятствие эволюционисты обходят "антипопперовским" тезисом о том, что в древности мой ключ выполнял какую-то другую, неизвестную, но полезную функцию. (В сценарии Дулиттла ключевой компонент ССК, фибриноген, полимеризующийся после активации в нити фибрина, образуется лишь на четвертом этапе);
  3. для многих доменов компонентов ССК до сих пор не найдены гомологи в гигантских базах данных геномов. На это есть два ответа, тактический и стратегический. Первый ответ гласит: "пока нет, но скоро будет". Второй ответ, своеобразная "Волга" эволюционизма, за которую уже некуда отступать (правда, и наступать уже некуда :-)) : "этот домен был еще в первичном органическом бульоне (а абиогенезом, как известно, теория эволюции не занимается!), затем он передался через примитивных предшественников предкам современных позвоночных". Другими словами, ртутный термометр придумали питекантропы, передавая тайное знание из поколение в поколение через жреческие касты.
  4. наконец, самое слабое возражение. Его слабина связана с тем двойным стандартом, который наблюдается в области эволюционной догматики. Чтобы утвердить какой-то тезис достаточно лишь показать, что не известны законы, прямо запрещающие данный сценарий. Чтобы опровергнуть эво-тезис, необходимо доказать, что его осуществление невозможно и невероятно при любых - известных и неизвестных, - условиях. Так вот, цитирую Бихи: " …(четвертая - К.В.) проблема сценария свертывания крови в том, что это сценарий избегает ключевых вопросов: "сколько", "как быстро", "где" и "когда". Ничего не говорится о количестве материала для свертывания, доступного в начале, … скорости образования сгустка после пореза, какому давлению жидкости может противостоять сгусток, насколько ущербно образование неадекватных сгустков, и еще о сотне других подобных вопросов".

...После выхода книги Бихи на многих эволюционистских сайтах стали появляться "опровержения" тезисов Бихи и "доказательства" эволюции рассмотренных им систем, в том числе и ССК. Одним из направлений критики являтеся поиск доказательств того, что ССК не является неупрощаемой системой. Одним из первых откликнулся Дулиттл (в "Бостонском сборнике" в 1997 году). Его статью и цитирует Марк Перах, в своем анти-Биховском труде, опубликованном в "Континенте" в 2001 году:

Имеется убедительное экспериментальное подтверждение избыточной сложности некоторых биохимических систем. Более того, некоторые из этих экспериментов продемонстрировали избыточную сложность как раз той системы свертывания крови, которую Бэхэ избрал примером предполагаемой неупрощаемой сложности. К середине девяностых годов биохимикам удалось разработать технику удаления индивидуальных генов из "генома" животных. Одним из примеров служит исследование, проведенное группой биохимиков, возглавляемой Бугге []. Работая с мышами, эти исследователи произвели поколение мышей, у которых был удален ген, ответственный за выработку фибриногена - белка, необходимого для свертывания крови. Естественно, мыши, лишенные фибриногена, потеряли способность к свертыванию крови и погибали от кровотечения. У другой группы мышей, исследователи удалили ген, производящий белок плазминоген, участвующий в приостановке свертывания крови и тем самым предотвращающий тромбоз (закупорку сосудов). Как и следовало ожидать, мыши, лишенные плазминогена, потеряли способность к своевременному прекращению свертывания крови и страдали от тромбоза. Однако затем исследователи скрестили обе разновидности мышей, и их потомство, лишенное как фибриногена, так и плазминогена, оказалось практически нормальным! Это блестящий эксперимент показал, что ансамбль белков, который согласно Бэхэ, якобы неупрощаемо сложен, на самом деле вовсе не весь необходим, и, следовательно, избыточно сложен. Как пишет известный биохимик, эксперт в биохимии свертывания крови, Р. Дулиттл , комментируя данные Бугге и соавторов, "Музыка и гармония могут быть достигнуты и с меньшим оркестром".

Что и говорить, сильный аргумент. Если верны факты. А факты говорят о том, что Дулиттл неправильно интерпретировал резюме статьи Бугге и соавторов: мыши, лишенные как фибриногена, так и плазминогена, действительно не страдают от тромбоза (нет фибриногена - нет и тромба), будучи полностью идентичными фибриноген-отрицательным мышам, с их кровоточивостью, 100% невынашиванием беременности и т.д. Другими словами, если фибриноген - двигатель автомашины, а плазминоген - ее тормоза, то машина без двигателя и тормозов будет также нефункциональна, как и машина без одного двигателя.

Для того, чтобы разобраться в вопросе, достаточно было внимательно прочитать статью или хотя бы резюме (оно доступно в интернете), или списаться с авторами (что я, например, сделал без всяких проблем). Бихи обратил внимание на ошибку в 1999 году, но Перах игнорировал опровержение Бихи, опубликовал русский перевод статьи в "Континенте" в 2001, а в своей новой англо-язычной версии добавил, что он лично больше доверяет Дулиттлу, чем Бихи, поэтому снимать аргумент с трансгенными мышами не собирается!

В действительности, давно известно, что дефицит по трем факторам, которых до недавнего времени относили к ССК, практически никак не сказывается на свертываемости - это факторы т.н. "контактной фазы", ф.XII, прекалликреин, HMK. Эти факторы лежат на стыке четырех систем (ССК, калликреин-кининовой, системы комплемента, и ренин-ангиотензиновой системы), наиболее удалены от конечного этапа свертывания, так что проблема здесь не в том, что ССК обладает избыточной сложностью, а в том, что мы еще не постигли сложность ее функционирования. В любом случае, имеется основной набор компонентов, без которых система не работает (а в половине случаев отсутствие компонента даже приводит к летальному исходу).

Другим направлением критики идей Бихи стала аргументация в пользу постепенного эволюционирования ССК. Наиболее толково (из найденных мной) написана статья профессора Кеннета Миллера "Эволюция ССК позвоночных" []. Миллер начинает с последнего, "слабого" возражения Бихи , и рассматривает примитивное беспозвоночное с низкими объемом и давлением крови. ССК отсутствует, но небольшие кровотечения останавливаются спазмом сосудов и прикреплением клеток крови к поврежденным участкам. В принципе, так и устроены современные асцидии и другие примитивные хордовые.

Основной тезис статьи Миллера заключается в том, что как раз для таких каскадных систем, как ССК, постепенное эволюционирование проще простого.
Вкратце и упрощенно, образование и распад сгустка крови можно разбить на четыре этапа.

  1. выход компонентов крови за стенки сосуда и реакция двух белков, которые в норме никогда не контактируют друг с другом - белка крови и белка, находящегося на поверхности тканевых клеток (тканевого фактора, TF).
  2. в результате реакции 1 белок крови активируется и запускает каскадную реакцию, активируя другой белок крови, тот третий и т.д. Таким образом за короткое время в крови образуется огромное количество конечного активного белка, который вступает в реакцию 3.
  3. активный белок, тромбин, отщепляет от белка фибриногена несколько "ненужных" кусков, в результате чего образующийся фибрин может полимеризоваться с образованием фибриновых нитей, лежащих в основе сгустка.
  4. одновременно с реакциями 1-3 запускаются процессы, приводящие к активации плазмина, который расщепляет фибриновый полимер, "растворяя" сгусток.

Миллер сокращает стадию усиления 2, оставляет стадии 1 и 3 так, что TF непосредственно активирует тромбин, а тот начинает образовывать мономеры фибрина. Миллер предполагает, что у простых хордовых такая система будет работать, ведь их кровеносные системы невелики и не испытывают больших нагрузок. Он выводит TF и тромбин из других белков, имеющие сходные домены - здесь он полностью повторяет Дулиттла, и мы приглядимся повнимательней к тому, что они предлагают.


Первая реакция свертывающей системы запускается выходом крови из поврежденного сосуда: белок крови FVIIa соединяется с рецептором TF ("тканевой фактор"), находящимся на поверхности тканевых клеток, но отсутствующим на поверхности клеток крови и внутренней стенки сосудов. Этот комплекс активирует фактор свертывания X (FX), который запускает дальнейшие каскадные реакции.

Как описывает первый этап эволюции Дулиттл?
(1) Инь: Тканевой фактор (TF) появляется как результат дупликации гена для [другого белка], который связывает домены для эпидермального фактора роста (ЕG). Продукт нового гена контактирует с кровью только после повреждения ткани.

Итак, появляется TF с подходящим распределением в тканях (отсутствует в крови и присутствует в тканевых клетках - фибробластах и т.п.). Однако его мишень - фактор VII - еще не съэволюционировал. Какова функция нового рецептора? Она отсутствует или неизвестна. Имеются десятки белков с доменом EG, предполагаемая функция которого - прикрепление к отрицательно заряженной клеточной мембране. "Родственники" ТF, имеющие подобную ему структуру - рецепторы к интерферону-альфа/бета , интерлейкинам 10 и 20, имеют дополнительные домены, другие функции, и экспрессируются в совершенно других клетках (лимфоцитах крови). Должен отметить, что фактор VII, естественная мишень для TF, образуется у Дулиттла на 13-м этапе эволюции!

Перейдем ко второму этапу эволюции по Дулиттлу--Миллеру.

(2) Ян: Протромбин появляется в древнем облике с добавленными EG доменами, результате ... дупликации гена протеазы и ... тасования. EG домен служит для прикрепления и активации тканевым фактором (TF).


Постулируемый "древний облик" протромбина значительно отличается от современного - последний не содержит EG домены, зато содержит кальций-связывающие Gla-домены (обозначены зеленым цветом, получены-де протробмином на 10-м этапе эволюции) и kringle-домены (синие, обменяны на EG-домены на 17-м этапе). У современных позвоночных образование тробмина происходит в результате каскада из двух ферментативных реакций, проходящих на поверхности тканевых клеток (TF:FVIIa+FX = FXa) и тромбоцитов (FVa:FXa + протромбин = тромбин, см. рисунок).

Итак, вроде бы первые два этапа эволюции (инь-ян) обеспечивают минимальную схему активации тромбина: контакт крови с тканями => TF+протромбин => активный тромбин.

Однако и здесь мы не можем перевести свой эволюционный дух и успокоиться. Активный тромбин получается из неактивного протромбина путем разрезания полипептидной цепочки. А тканевой фактор (TF) ферментативными свойствами не обладает!

Далее, допустим, что тромбин все-таки образовался при контакте крови с тканевыми клетками. Однако его субстрат - фибриноген - еще не появился в процессе эволюции (нужно ждать этапа 4), так что свертывания крови все равно не происходит. Если же древний тромбин обладал свойствами, подобными современному тромбину, то в отсутствие инактиваторов он подобен слону в посудной лавке, неспецифически расщепляя другии белки крови и тканей.

Наконец, последнее замечание. Известны случаи, когда бактерии быстро вырабатывают невосприимчивость к антибиотикам или относительно новую реакцию (расщепление нефти) за счет мутаций одного гена. В принципе, можно допустить плавное изменение двух генов, кодирующих взаимодействующие белки. А теперь еще раз приглядитесь к картинкам: обе реакции из современной ССК осуществляются комплексами из ЧЕТЫРЕХ компонентов: отрицательно заряженной поверхности, белка-активатора, активирующей протеазы и активируемой протеазы. Подавляющее большинство реакций ССК осуществляются такими комплексами из трех белков!

Еще раз: первые два этапа эволюции свертывающей системы по Дулиттлу и Миллеру предполагают образование двух древних факторов свертывания с иной структурой, типом взаимодействия и функцией, чем у их постулируемых потомков, и, главное, не обеспечивающих функцию свертывания !

О функции свертывания можно говорить лишь после образования фибриногена. О его эволюции Дулиттл пишет очень лаконично:

4) Снова инь: Рождается фибриноген, внебрачный сын от тромбин-чувствительного [удлиненного] отца и [белка с компактной структурой в качестве] матери.

Миллер же упоминает о фибриногене в самом конце своей статьи, как кульминации торжества эволюционизма:

Схему [эволюции] можно подвергнуть другим многочисленным тестам, из нее можно вывести другие предсказания, но одно из самых смелых было сделано самим Дулиттлом более десяти лет назад. Если современный фибриноген действительно был рекрутирован из древнего предкового гена, который никак не был связан со свертыванием крови, то нам нужно было бы найти фибриноген-подобный ген в животном, у которого нет системы свертывания как у позвоночных. Другими словами, нам нужно найти несвертывающий фибриноген-белок у беспозвоночных. Это очень смелое предсказание, потому что, если бы его не нашли, то это бросило бы тень на всю эволюционну схему Дулиттла.

Но не волнуйтесь. в 1990 году Сюн Ю и Дулиттл выиграли свое пари, найди фибриноген -подобную последовательность в морском огурце, иглокожем. Ген фибриногена у позвоночных, как и гены других белков системы свертывания, был образован дупликацией и модификацией пред-существовавших генов.

Обратимся теперь к структуре фибриногена, чтобы увидеть то, о чем умолчали Дулиттл и Миллер. Фибриноген - ключевой компонент системы свертывания крови, его модификация и полимеризация обеспечивает образование сгустка, закупоривающего пораженный участок сосуда.
Чисто теоретически можно предположить, что это белок должен иметь по крайне мере несколько важных участков:
1. участок, ответственный за активацию тромбином;
2. участки, ответственные за полимеризацию,
3. участок, ответственный за разборку полимера плазмином.
4. участки, обеспечивающий прикрепление к различным поверхностям.

И действительно, этот белок обладает значительной (неуменьшаемой!) сложностью, он состоит из трех пар субъединиц (2 альфа, 2 бета, 2 гамма), сшитыми ковалентными связями, и принимающими форму скрученного стержня.

При взгляде на рисунок сборки фибрина очевидно, что необходима точная подгонка субъединиц друг ко другу, обеспечивающая образование фибрин-димера и фибрин-полимера. Вся сложность этого комплекса описывается у Дулиттла одним словом: "рождается"!

Каждая из субъединиц состоит из нескольких доменов:

sig p Pfam-B_13767 low complexity Pfam-B_13767 coiled coil Pfam-B_13767 Pfam-B_25768 low complexity Pfam-B_36900 low complexity Pfam-B_36900 low complexity Pfam-B_36900 Pfam-B_27780 low complexity Pfam-B_27780 low complexity Pfam-B_27780 smart: FBG 627-629 fibrinogen_C 630-863 : Fibrinogen beta and gamma chains, C-terminal globular domain предшественник альфа субъединицы состоит из пяти доменов, общей длиной 866 аминокислотных остатков (а.о.),
sig p Pfam-B_28344 Pfam-B_5647 coiled coil Pfam-B_5647 fibrinogen_C 237-487 : Fibrinogen beta and gamma chains, C-terminal globular domain предшественник бета-субъединицы - 3 домена, 491 а.о.
sig p transmembrane Pfam-B_5647 coiled coil Pfam-B_5647 coiled coil Pfam-B_5647 fibrinogen_C 175-415 : Fibrinogen beta and gamma chains, C-terminal globular domain предшественник гамма-субъединицы - 2 домена, 453 а.о.

Что же представляет из себя "фибриноген-белки" беспозвоночных?

На самом деле, подобие фибриногену им придает домены, гомологичные лишь одному из доменов цепей фибриногена - С-концевому домену FibC ("fibrinogen_C" на рисунках). У оставшихся пяти доменов фибриногена не найдены гомологи ни у позвоночных, ни у беспозвоночных!

sig p fibrinogen_C 66-280 : Fibrinogen beta and gamma chains, C-terminal globular domain фибриногено-подобный белок морского огурца (282 а.о.)

sig p transmembrane low complexity coiled coil coiled coil coiled coil low complexity coiled coil low complexity low complexity coiled coil coiled coil fibrinogen_C 513-684 : Fibrinogen beta and gamma chains, C-terminal globular domain smart: FBG 685-711 low complexity

Белок дрозофилы SCA-DROME, 744 а.о.

Какова же степень гомологии у "фибриногена" морского огурца и FibC-домена субъединиц фибриногена человека? Она не превышает 30-42% (75 аминокислот из 250 совпадают и еще 30 относятся к одной и той же группе)

FIBA_PARPA/66-280< /NOBR>   YPRDCYDILQS..CSGQSPPSGQYYIQPDGGN..LIKVYCDMETDEGGWTVFQRRIDGTINFYRSWSYYQTGFGNLN...
FIBB_HUMAN/237-487   SGKECEEIIRK..GGETS...EMYLIQPDSSV.KPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNT

FIBA_PARPA/66-280< /NOBR>   .........TEFWLGNDNIHYLTSQG..DYELRVELNNTLGNHYYAKYNKFRIGDSFSEYLLVLGAYSG...........
FIBB_HUMAN/237-487   DGKNYCGLPGEYWLGNDKISQLTRMG..PTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRG.TAGNALMDGA

FIBA_PARPA/66-280< /NOBR>   ....TAGDSLAYHNTMRFSTYDNDND.....VYSINCASHSSYGRGAWWYKSCLLSNLNG.QYYDYSGAPS.........
FIBB_HUMAN/237-487   SQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGG...WWYNRCHAANPNGRYYWGGQYTWD.MAKHGTDD


FIBA_PARPA/66-280< /NOBR>   .IYWSYLPGDNDQIPFAEMKLRNR
FIBB_HUMAN/237-487   GVVWMNWKGSWYSMRKMSMKIRPF

Но самое интересное начинается тогда, когда мы проанализируем филогенетическое дерево всех FIBC доменов, скачав его из интернет-базы данных Pfam.

В графическом виде это дерево (упрощенное) можно посмотреть здесь: fibc.wmf, а мы представим упрощенную классификацию. Чем длиннее номер в классификации (например, 2.2.2.1.), тем позже эволюционировал предшественник данного гена. Белки млекопитающих (и, чаще всего, позвоночных) обозначены жирным синим шрифтом. Стрелка (А -> B) означает "из предка А произошел предок В", но эволюционисты часто упрощают эту фразу до "из А произошел В".

"Эволюционное древо" FIBC

0. Общий предок доменов FIBC

1. белки круглых червей (нематод) -> белки плодовой мушки дрозофилы -> неурексин IV
2.
2.1. белки дрозофилы -> фибриноген А позвоночных -> белки краба -> белки улитки -> фибриноген B большинства позвоночных
2.2.
2.2.1.
2.2.1.1. белок москита -> белок нематод -> интелектин -> белки улитки
2.2.1.2. белки нематод -> фибролейкин 2 -> фибролейкин 1 -> белки улитки и дрозофилы
2.2.2.
2.2.2.1. фибриноген B быка и человека -> тахилектин краба -> ANL4
2.2.2.2.1. фибриноген-гамма PETMA -> hfarp белок
2.2.2.2.2. ангиопоэтины -> ANL3 -> ANL2 -> фибриноген-гамма< br> 2.2.2.3.
2.2.2.3.1. белки дрозофилы, в т.ч. SCA DROME
2.2.2.3.2. тенасцины -> белок комара -> тенасцины птиц
2.2.2.3.3. белок морского огурца FIBA-PARPA, белки улитки -> фиколины

В первую очередь бросается в глаза перемешанность белков млекопитающих/позвоночных с белками улиток, дрозофил, червей и т.д. Строго по Дулиттлу эволюция должна была бы проходить так: все "синие" домены позвоночных группируются в одном поддереве, беря начало от какого-нибудь белка низшего животного, хоть того же морского огурца. Если же подходить к филогенетическому дереву "по-простому", то тогда белок морского огурца произошел от фибриногена позвоночных, а не наоборот!

Как же могут решать проблему "неправильного" расположения отдельных веток на древе эволюционисты? С помощью трех объяснений.

  1. Изменения генов и их продуктов-белков во времени - процесс, связанный со случайными мутациями, поэтому возможны отдельные "выбросы". Кроме того, возможен горизонтальный перенос генов между удаленными классами животных за счет вирусов. Но это объяснение не проходит в нашем случае: тогда все дерево - сплошная случайность или результат вирусных перестроек. (Хотя, ради сохранности остальных эво-древ, можно одним и пожертвовать).
  2. Данное дерево - результат ограниченности и неточности математических методов, лежащих в основе вычислений. Тогда резонен вопрос: почему в случаях, когда эти методы дают удобные результаты, вопросов не возникает? Какова частота ошибочных построений деревьев?
  3. Если белок примитивного животного "происходит от" белка высшего животного, то это обозначает лишь, что разделение произошло на еще более ранней стадии -- у их общего пра-предка. Сомнения это объяснение вызывает как с позиции хронометража событий, так и тем, что мы опять уводим всю биохимическую эволюцию если не на стадию абиогенеза, то хотя бы на стадию низших многоклеточных. Понимаете, получается, что у какого-то низшего кишечно-полостного произошла следующая эволюция домена FibC:

Предок неурексина IV -> предок фибриногена-альфа -> -> предок фибриногена-бета -> предок фибриногена-гамма -> предок белка дрозофилы SCA DROME -> предок тенасцинов -> предок белка морского огурца FIBA-PARPA -> предок фиколинов.

--А последующие полмиллиарда лет домены FibC лишь терялись или незначительно дивергировали в пределах своей подгруппы. Что ж, это - тенденция, которая прослеживается во всем эволюционизме, как в в эво-деревьях таксонов животных, так и в биохимических эво-деревьях: им на смену приходят эво-кустарники и эво-луга,

Итак, мы можем составить эволюцию фибриногена, непротиворечащую данным:

"Когда беспозвоночный предок превращался в позвоночное, и ему нужно было срочно получить систему свертывания, то предсуществующие три разных домена FibC перетасовались с другими предсуществующими пятью доменами, так, что образовались гены трех субъединиц фибриногена. У тех беспозвоночных, которые не превратились в позвоночных, соответствующие домены, кроме одного, исчезли."

Но вот через десять лет после своей инь-ян истории Р. Дулиттл публикует новую статью: "Эволюция свертывания крови позвоночных, рассмотренная путем сравнения геномов асцидии и иглобрюха [рыбы]" (Jiang Y. and R. Doolittle, PNAS, 2003, Vol. 100(13):7527-32). Я очень надеялся, что статья Дулиттла прольет свет на темные стороны формирования ССК. Как ни странно, она это сделала. Вопреки оптимизму авторов из статьи явствует три важных вывода:

  1. У асцидии (хордовое, но непозвоночное животное) отсутствуют ВСЕ факторы свертывания, нет даже белков, имеющих хотя бы последовательность тех же доменов, что и белки ССК.
  2. За 50-100 постулируемых млн. лет у предка рыб (хордовые, позвоночные) появились 28 из исследуемых 32 генов ССК, причем три из отсутствующих генов кодируют факторы "контактной системы" (которая, как мы помним, не критична для свертывания).
  3. За последующие постулируемые 400 млн. лет ССК рыб и их потомков, млекопитающих, практически не разделились: пара дупликаций у рыб, пара - у млекопитающих. Даже некодирующие участки генов, интроны, у рыб и млекопитающих практически совпадают.

В принципе, статья Дулиттла, вышедшая в 1993 году, сравнивающая геномы беспозвоночных хордовых, рыб и человека, свидетельствует о том же (вопреки выводам автора):

(2. филогенетические деревья для доменов свидетельствуют как против схемы Дулиттла, так и против постепенной эволюции факторов вообще - написать)

.........................

 

Остается только добавить, что история эволюции свертывающей системы Дулиттла, как и многие другие, сочиненные эволюционистами, не ДОКАЗЫВАЕТ эволюцию, и даже не ОБЪЯСНЯЕТ ее. Сзади ее подпирает кредо эволюцинизма: "мы не знаем, как это было, но верим, что как-то уж съэволюционировало".